SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005280 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005280
Domain Number 1 Region: 258-356
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-21
Family PDZ domain 0.00091
Further Details:      
 
Domain Number 2 Region: 26-129
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-17
Family PDZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 152-236
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-17
Family PDZ domain 0.0062
Further Details:      
 
Domain Number 4 Region: 397-482
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-16
Family PDZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005280   Gene: ENSMPUG00000005318   Transcript: ENSMPUT00000005368
Sequence length 505
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:7907758:7911442:1 gene:ENSMPUG00000005318 transcript:ENSMPUT00000005368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAATGLRDTASLTARKFEFNPKWGIDNPVLSLAEDFDPSDLQRLQRPRFCLLSKEEGSS
FGFHLQELGRAGPVVCRVDPGTSAQYQGLREGDRILGVNDRVVECEDYAVVVRCIRDSGP
RVLLTVLAQHVHDVARAQQGNSACLCPPLGPGVRPRLCHVVKDEGGFGFSVSYSHQGPFW
LVLSTGGAAERAGVPPGARLLEVNGVSVEKFTYHQLSRKLSQSGDQVTLLVAGPEVEERC
RQLGMPLAAPLAEGWALPTRPRRLHLKKGSQGFGFLLREEKGLDGRPGQFLWEVDPGLPA
EKAGMQAGDRLVAVAGESVEGLGHEETVARIRAQGSCVSLIVVDPKADRFFSMVRLSPLL
FLESTEAPASPQETCSASLVETKDLPVEDTAVPLVPGGSRQCSLYPAPGGGYGFRLSCVA
SEPRIFISQVTLGGSAAQAGLQMGDVILEVNGYPMGGENDLEKLQQLAVAEPPLHLKLAV
RSCQGSEACNPPGFGEDWAPVSELL
Download sequence
Identical sequences M3Y1S9
ENSMPUP00000005280 XP_004750087.1.14098 ENSMPUP00000005280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]