SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005307 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005307
Domain Number 1 Region: 145-338
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.01e-74
Family T-box 0.000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005307   Gene: ENSMPUG00000005346   Transcript: ENSMPUT00000005396
Sequence length 612
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897082.1:1593356:1621587:1 gene:ENSMPUG00000005346 transcript:ENSMPUT00000005396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAVAVDDGGCSRGGG
AGEKGSSEGDEGAALPPPAGAASGPARSCADLERSCGSRGAAGGCEDGFLQGASPLASPG
GSPKGSPAPPLARPGTPLPSPPAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVK
ISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETW
MRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKA
FSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTL
TFEDIPGIPKQGNTSSSTLLQGSGNGVPATHPHLLSGSPCSSPAFHLGPNTSQLCSLAPA
DYSACARSGLTLNRYSTSLAETYNRLTNQSGETFAAPRTPSYVGVSGSASVNMSMGGTDG
DTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFAANQTHQGSYNTFRLHSPCALYGYNFS
TSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSL
TLSSSQVSAHMV
Download sequence
Identical sequences M3Y1V6
XP_004773642.1.14098 ENSMPUP00000005307 ENSMPUP00000005307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]