SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005315 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005315
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-18
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005315   Gene: ENSMPUG00000005354   Transcript: ENSMPUT00000005404
Sequence length 402
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:1939012:1946787:-1 gene:ENSMPUG00000005354 transcript:ENSMPUT00000005404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGQGLQDGNHPSAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYVSDKEVKDEKNI
QEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWISA
LNSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLT
LDLIQEEDPSPEEPNSCAESFRVDLDKSVAQLAGGRRRADSDRIQPSSDRASGLPRSWEK
PDKGATYTPQAPKKLTTTEKGRCASLEEILSQRDPAPARTLQLRPEDPPSLLPPHPGQLS
RIQDLVARKLEKTQELLAEVQGLGDGKRKAKDPPRSPDSESEQLLLETERLLGEASSNWS
QAKRVLQEVRELRDLYRQMDLQTPDSHLRPAPQHSQYRKSLM
Download sequence
Identical sequences M3Y1W4
ENSMPUP00000005315 ENSMPUP00000005315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]