SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005317 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005317
Domain Number - Region: 461-608
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000492
Family BAR domain 0.068
Further Details:      
 
Domain Number - Region: 352-427
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.0628
Family Influenza hemagglutinin (stalk) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005317   Gene: ENSMPUG00000005356   Transcript: ENSMPUT00000005406
Sequence length 642
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:13849276:13900522:-1 gene:ENSMPUG00000005356 transcript:ENSMPUT00000005406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSSVSTGGAGRLSMQELRSQDLNKQGLHTPQTKEKPTFGKLNINKPTSERKVSVFGKR
TSGHGSRNSQFGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAYSVSMKSLQAP
SVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPH
IVAALVWLIDCIKLHNAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMTGA
DSFEEMNAELQSKLKDLFNVDASKLESLATKNKALNEQIARLEQEREKEPNRLESLRKLK
TSLQADVQKYQAYMSNLESHSAILDQKLNGLDEEISRVELECETMKQENTRLQNIVDNQK
YSVADIERINHERNELQQTINKLTKDLEAEQQQLWNEELKYARGKEAIETQLSEYHKLAR
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNQTEEEINKALNKKM
GLEDTLEQLNTMITESRRGVKTLKEEVQKLDDLYQQKVKEAEEEDKKCASELESLEKHKH
LLESAVNEGLSEAMNELDAIQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL
EEQIAKVEREYEEYMSEDLLENIREIGDKYKKKAALIKPSDE
Download sequence
Identical sequences M3Y1W6
ENSMPUP00000005317 XP_004742850.1.14098 XP_012906891.1.14098 ENSMPUP00000005317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]