SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005333 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005333
Domain Number 1 Region: 61-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005333   Gene: ENSMPUG00000005372   Transcript: ENSMPUT00000005422
Sequence length 303
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896987.1:5317427:5323080:-1 gene:ENSMPUG00000005372 transcript:ENSMPUT00000005422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKPKIVLRGKSIKRAPGEETEKEEEEEDREEEDENGLPRRRGLRKKKTTKLRLERVKF
RRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGK
RPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSP
ELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLK
QEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAV
FHN
Download sequence
Identical sequences A0A1U7SVV8 M3Y1Y2
XP_004762651.1.14098 XP_005628750.1.84170 XP_006742669.1.47382 XP_008049625.1.4292 XP_011278754.1.62641 XP_019299284.1.44245 XP_021545443.1.83697 ENSMPUP00000005333 ENSMPUP00000005333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]