SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005348 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005348
Domain Number 1 Region: 9-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.83e-64
Family TRADD, N-terminal domain 0.000000182
Further Details:      
 
Domain Number 2 Region: 223-310
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000753
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005348   Gene: ENSMPUG00000005387   Transcript: ENSMPUT00000005437
Sequence length 314
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:18143127:18145079:-1 gene:ENSMPUG00000005387 transcript:ENSMPUT00000005437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGSNGLDEWVGSAYLFVESSLDKVVLSDAYAHAQQKVPVYRALRTALTESGGSPDVLQ
MLKIHRSEPQLIVQVRFRGRQPCSRFLRAYREGSLRATLQECLAGALALHSVPLQLELRA
GTERLDTLLTDEERCLSCIFAQKPDRLRDEELSELEEALRNLTCGSGSQGGNMEVVPAPS
QSLTTSLSEEKPPAPPPPPPVQTFLFQGQPIVNRPLSLQDQQTFARSVGVKWRKVGRSLQ
RGCRALRDPALDSLAYEYEREGLYEQAFQMLRRFVQAEGRRATLQRLVEALEENELTSLA
EDLLGLTNPDGSLA
Download sequence
Identical sequences M3Y1Z7
ENSMPUP00000005348 XP_004744405.1.14098 ENSMPUP00000005348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]