SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005369 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005369
Domain Number 1 Region: 248-383
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.37e-42
Family Synaptotagmin-like (S variant) 0.00000593
Further Details:      
 
Domain Number 2 Region: 109-222
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.28e-39
Family Synaptotagmin-like (S variant) 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005369   Gene: ENSMPUG00000005408   Transcript: ENSMPUT00000005458
Sequence length 396
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897048.1:4873506:4926489:-1 gene:ENSMPUG00000005408 transcript:ENSMPUT00000005458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKLKDSSTLGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHARLQRQTTEPASSTRHTS
FKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPELYKQKSVDGDDAKSEAAKSCGKIN
FSLRYDYESETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTF
DENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEVSDLSRETSIWKDIQY
ATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKK
KKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGINAEGL
GRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGNPRL
Download sequence
Identical sequences M3Y218
ENSMPUP00000005369 ENSMPUP00000005369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]