SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005370 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005370
Domain Number 1 Region: 498-763
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-81
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 335-453
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-33
Family Pleckstrin-homology domain (PH domain) 0.0000116
Further Details:      
 
Domain Number 3 Region: 29-101
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.2e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 175-233
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005370   Gene: ENSMPUG00000005409   Transcript: ENSMPUT00000005459
Sequence length 824
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896946.1:1419391:1569898:1 gene:ENSMPUG00000005409 transcript:ENSMPUT00000005459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDKILLFRHDPTSENILQLVKTASDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRA
PAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGLSTVR
TASAELSTSAPEEPLLSPVSPGFEQKSPSESFIGREKRSNSQSYIGRPIQLDKILMSKVK
VPHTFVIHSYTRPTVCQYCKKLLRGLFRQGLQCKDCRFNCHKRCASKVPNNCLGEVTING
DLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEVVMAECQNDSGEMQDPDPD
PEDSNRTISPSTSNNIPLMRVVQSVKHTKRKSSTVLKEGWMVHYTSKDTLRKRHYWRLDS
KCITLFQNDTGSRYYKEIPLSEILSLEPAKPSDLIPNGANPHCFEITTANVVYYVGENVV
NPSSPPPNSSVLTSGVGADVARMWEMAIQHALMPVIPKGSTVGSGTNSHRDVSVSISVSN
CQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLR
NEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLIT
QILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPA
YLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEI
SHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLR
WEQYAGEQGLQYPAHLINPSASHSDNPENEETEMKALSERVSIL
Download sequence
Identical sequences M3Y219
ENSMPUP00000005370 ENSMPUP00000005370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]