SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005371 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005371
Domain Number 1 Region: 153-284
Classification Level Classification E-value
Superfamily GAT-like domain 3.34e-47
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.00000102
Further Details:      
 
Domain Number 2 Region: 23-148
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.89e-45
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005371   Gene: ENSMPUG00000005410   Transcript: ENSMPUT00000005460
Sequence length 905
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897082.1:2510452:2657533:1 gene:ENSMPUG00000005410 transcript:ENSMPUT00000005460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMA
DTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDM
STFIRRYSRYLNEKAFSYRQMAFDFARVKKGADGVMRTMAPEKLLKSMPILQGQIDALLE
FDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRF
LTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQHLNTLEGKKPGNKSGAPSPL
SKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGGAA
AAAAPAPPPPSGGATAWGDLLGEDSLAALSSVPSEAQISDPFAPEPTPPTTTSEIATASA
SASTTTTVTAVTADVDLFGDAFAASPGEAPAASEGAAAPATPAPVAAALDACSGNDPFAP
SEGSAEAAPELDLFAMKPPETSVPVVTPTASTAPPVPATAPSPAPAVAAATAATTAAATT
TAAATATTSATTTAAPPALDIFGDLFEAPPEVAAAPKPDAAPSIDLFGTDAFSSPPQGAS
PVPESSLTADLLSVDAFATPSPATTASPAKVDSSGVIDLFGDAFGSSASEPQPAPQAASS
SSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEAAFGTTPSTSSSSSFDPSVFDGLG
DLLMPTMAPTGQPAPISMVPPSPAMAASKALGSDLDSSLASLVGNLGISGTTSKKGDLQW
NAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPASSVPPVAGAPSVGQPGAGFGM
PPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPATQSPKKPPAKDPLADLN
IKDFL
Download sequence
Identical sequences M3Y220
ENSMPUP00000005371 XP_012901837.1.14098 ENSMPUP00000005371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]