SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005374 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005374
Domain Number 1 Region: 866-1010
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-28
Family Bromodomain 0.00049
Further Details:      
 
Domain Number 2 Region: 197-258
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 805-865
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.21e-16
Family PHD domain 0.0038
Further Details:      
 
Domain Number 4 Region: 51-126
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000322
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005374   Gene: ENSMPUG00000005413   Transcript: ENSMPUT00000005463
Sequence length 1055
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897048.1:5129056:5241105:-1 gene:ENSMPUG00000005413 transcript:ENSMPUT00000005463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSAPAASAPAASVGPGVPGGAVSTPAPAPASAPAPGPSAGPPPGPPASLLDTCAVCQQSL
QSRREAEPKLLPCLHSFCLRCLPEPERQLSVSIPGGSNGDIQQVGVIRCPVCRQECRQID
LVDNYFVKDTSEAPSSSDEKSEQVCTSCEDNASAVGFCVECGEWLCKTCIEAHQRVKFTK
DHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQLLEHKEHRYQFL
EEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQEIKVAIFTLINE
INKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNWAIASGSSTALLYSK
RLITFQLRHILKARCDPVPAANGAIRFHCDPTFWAKNVVNLGNLVIESKPAPGYTPNVVV
GQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQPPAPVSTTTTTTQQ
HPRQAAPQMLQQQPPRLISVQTMQRSNMNCGAFQAHQMRLAQNAARIPGIPRHSGPQYSM
MQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSPSVTAIELIPSVT
NPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPSPGPSALSPGSSG
LSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKTGLSFKSDQVKVKQEPGTEDEVCSFSGAV
KQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALASLENHVKTEPADTNESCKQS
GLSSLVNGKSPIRSLIHRSSRIGGDGSSKDDDPNEDWCAVCQNGGDLLCCEKCPKVFHLT
CHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLY
LYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQTPDDFVADVRLIF
KNCERFNEMMKVVQVYAETQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEF
EQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
Download sequence
Identical sequences M3Y223
ENSMPUP00000005374 ENSMPUP00000005374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]