SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005375 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005375
Domain Number 1 Region: 118-241
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-27
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 2 Region: 19-115
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-24
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 316-365
Classification Level Classification E-value
Superfamily RING/U-box 0.00000412
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005375   Gene: ENSMPUG00000005414   Transcript: ENSMPUT00000005464
Sequence length 380
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896976.1:7689100:7707613:-1 gene:ENSMPUG00000005414 transcript:ENSMPUT00000005464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKETLLAGHLQCSPEQAVELSALLAQ
TKFGDYNQNTAKYSYEELCAKELSSTTLNSIVAKHKELEGTSQASAEYQVLQIVSAMENY
GIEWHSVRDSEGQKLLIGVGPEGISICKDDFCPINRIAYPVVQMATQSGKNVYLTVTKES
GNSVVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLFLNENI
NLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSEHSPPSSPLKSSESSLNCTSCEG
LSCQQTRALQEKLRKLKEAMLCMVCCEEEINSAFCPCGHTVCCEGCAAQLQSCPVCRSRV
EHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences M3Y224
ENSMPUP00000005375 XP_004761341.1.14098 ENSMPUP00000005375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]