SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005385 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005385
Domain Number 1 Region: 595-683
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-18
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 394-487
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 284-335
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000824
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005385
Domain Number - Region: 561-594
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000157
Family Second domain of FERM 0.0041
Further Details:      
 
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00924
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005385   Gene: ENSMPUG00000005424   Transcript: ENSMPUT00000005474
Sequence length 706
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:7433527:7524021:-1 gene:ENSMPUG00000005424 transcript:ENSMPUT00000005474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGTDVL
YIGPLKGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITS
PEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAI
RINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAA
LSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKS
KEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMA
ACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKK
YKNKQEKGCKKQMPGYIRDLITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFI
ARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRL
SFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences M3Y234
ENSMPUP00000005385 ENSMPUP00000005385 XP_010960467.1.22495 XP_010981231.1.51371 XP_012613452.1.48125 XP_012911740.1.14098 XP_015091049.1.17985 XP_017203798.1.1745 XP_019581265.1.88060 XP_019581266.1.88060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]