SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005489 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005489
Domain Number 1 Region: 995-1213
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 862-982
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000322
Family PLC-like (P variant) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005489   Gene: ENSMPUG00000005531   Transcript: ENSMPUT00000005581
Sequence length 1226
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896933.1:13024296:13072449:1 gene:ENSMPUG00000005531 transcript:ENSMPUT00000005581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPLRRTLSRLRGRRSPRAAGGLGLRAAAAATVAASAVAEGDAGRAPDARPGKHARAAR
PSLEQPSPSPHAWAPEARVPGGRPEQWGALGPRQRGGKEAFSSGGGLPRACLHAPPGSEG
SGEEEDDREDDADYYENLPGGSHSAPKPKGAEAERWPPPPPAAGSSPGAEGGRQETGRLQ
TQLREAYYLLIQAMHDLPPDSGARRGDRGWADRGCLVGARALGQPPSPCGAADRRACPQD
WQRGGGGRPWQQVSPPRSPPRESGKGRLRTPRMRLSCSRSLESLGVGAKPLPFQRWPSDS
WIRCGARGDLDEPPPRGGGMDGWSGGSVPAAAPSDHLTSRSRDPGRSSGSPFREPAGSAV
LRSGKENGQEGLPFLKPPAVTVKKLQKWMYKGRLLSLGMKGRSRGAPPKVTGAQATSPNL
GPLKMHESQVLSVPPDQRITLTDLFENVYGSSVKRRELEDLKDNIGFRSHKPLNSITVSK
KRNWLYQSTLRPFNLEEQNKKCQDLSHLSISPKHQLSRPFFKSSEEYCTYMVCDATDSSP
SRNCSLDFNEENDADDEREIWYNPIPEDDDFGISNALSFGEADSPVLKFPTVSLRVLSGS
DLMKAEQYTEDLLCSSELRSTQSNETNPVDPIHSPEIMQPFKQRVGHKTQEGIMVEESLM
LKSPFAGPGSLAATNKTELGVPEPSSLSPSPVKKNSSINWSFPDKIKSPRTVRKLSMKMK
RLPELSRKLSVRGTLNHTNSPDNTPSLSKCNCQEIHHTDILPSGNTTTAAKRNVISRYHL
DTSVSSQHSYQKKTFMSSKYSCKGGYLSDGDSPELITKSIKHGSENKFGKGKEITPNSCS
KSEIDIDAFRHYSFSDQPKCSQYISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKA
RTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTLFRVTK
THQLAVKLEPRGLIYVKVTLLEQWENSLHGLDINREPVIFGVDIRKVVEKENIGLMVPLL
IQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLK
DYLRELPSPLITKQLYEAVLDTMAKNPLKMSSSGCENDPSDSKYTVDLLDCLPDVEKATL
KMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQETSTHNNRVFTDSEELASALDFK
KHIEVLHYLLQLWPGNKGRLLVVNAV
Download sequence
Identical sequences M3Y2D8
ENSMPUP00000005489 ENSMPUP00000005489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]