SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005568 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005568
Domain Number 1 Region: 120-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.93e-70
Family Arfaptin, Rac-binding fragment 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005568   Gene: ENSMPUG00000005613   Transcript: ENSMPUT00000005665
Sequence length 341
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897276.1:262581:269122:1 gene:ENSMPUG00000005613 transcript:ENSMPUT00000005665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTTPAGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Download sequence
Identical sequences A0A1U7T2V4 A0A250XYV7 A0A287DDT6 A0A2K6EJC7 D2HR63 E2QV23 G5BBQ8 M3W2J5 M3Y2L7
ENSAMEP00000017247 9615.ENSCAFP00000009675 HGL_H00000254584 ENSAMEP00000017247 ENSCAFP00000009675 ENSSTOP00000013470 ENSFCAP00000004279 XP_002925019.1.58354 XP_003992981.2.62641 XP_004413368.1.74151 XP_004413369.1.74151 XP_004650981.1.11716 XP_004781221.1.14098 XP_004863458.1.39548 XP_005341165.1.77405 XP_005380206.1.28644 XP_005633665.1.84170 XP_006732801.1.47382 XP_006732802.1.47382 XP_006732803.1.47382 XP_007083217.1.5354 XP_007083218.1.5354 XP_008048196.1.4292 XP_008709193.1.72690 XP_008835615.1.79516 XP_010642550.1.5607 XP_012422439.1.74151 XP_012509799.1.63892 XP_012509801.1.63892 XP_012641991.1.48125 XP_012641992.1.48125 XP_014934766.1.86478 XP_015333053.1.40921 XP_019311682.1.44245 XP_019311683.1.44245 XP_019667533.1.62641 XP_020034918.1.5219 XP_020034919.1.5219 XP_021541381.1.83697 ENSMPUP00000005568 ENSMPUP00000005568 ENSCAFP00000009675 ENSSTOP00000013470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]