SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005574 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005574
Domain Number - Region: 155-224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.009
Family FCH domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005574   Gene: ENSMPUG00000005619   Transcript: ENSMPUT00000005671
Sequence length 592
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897022.1:4138991:4176403:1 gene:ENSMPUG00000005619 transcript:ENSMPUT00000005671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDEEKGSLPVLQNDSERGSSVSSDLQEEYEELLRYTIVTPNIESGALQPCHSKGEVVP
DVRVPTIIDNILHNQAGNSPVVRETRMEVGKGCDLNISSHSKTDGSSPVSSPRKPSHPVM
DFFSSNLLGDSSSPASISSHADVHEIVVSDFLISNENLQKMENVLDLWSSGLKTNIISEL
SKWRLNFIDWHRMEMKKEKEKHAAHLKQLCNQINSLKELQKAYEVSIGRKDEVISSLSHA
IGKQKERIELMRTFFHWRIGHVKCRQDAYEGKLADQYFQRTLLKKVWKGWRSIVQKQWKD
VVERACQARAEEVCVQISNDYEARVAVLSGALENAKAEIQRMQQEKEHFEDSMKKAFMRG
VCALNLEAMTIFQNRGDTGIDLTNKKEEYGPGVQGKEHSSQSDSLAPQMPSVVALPPSPP
AAAMGAASASAFTSAASVTSAGATSASSAHLPVSTALGSGSTAAAHLPVSTTLGSGSTAA
AAPEEMYVPRIVTSAQQKAGRTITARITGRCDFASKNRVSSSLAIMGVSPPMSSVVVEKH
HPVTVQTIPQAAAAKYPRTIHPESSTSASRSLGTRSTHTQSLTSIHSIKVVD
Download sequence
Identical sequences M3Y2M3
XP_004766905.1.14098 ENSMPUP00000005574 ENSMPUP00000005574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]