SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005576 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005576
Domain Number 1 Region: 322-381
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.6e-18
Family Erythroid transcription factor GATA-1 0.00051
Further Details:      
 
Domain Number 2 Region: 269-318
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000451
Family Erythroid transcription factor GATA-1 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005576   Gene: ENSMPUG00000005621   Transcript: ENSMPUT00000005673
Sequence length 482
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:17362885:17392676:1 gene:ENSMPUG00000005621 transcript:ENSMPUT00000005673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTDGGWCLPKRFGAAAADASDSGTFPVREPSTPPSPISSSSSCCSRGGERGPGGASNC
RTPQLDTEAAAGPPARSLLLSPYASHPFGAPHGPSAPGVAGPGSALSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPGAYDGAPGGFVHSAAAAAAAA
AAAXGGGSLAAMGAREHQYSSLSAARPLNGTYHHHHHHPNPYSPYVGAPLTPAWPAGPFD
TPVLHSLQSRAGAPLPVPRGPSADLLEDLPESRECVNCGSIQTPLWRRDGTGHYLCNACG
LYSKMNGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLH
GVPRPLAMKKEGIQTRKRKPKNINKSKACSGSSNNSVPMTPTSTSSNSDDCSKNTSPTTQ
PQPTASGAGASVMSGTGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALA
LA
Download sequence
Identical sequences M3Y2M5
ENSMPUP00000005576 ENSMPUP00000005576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]