SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005588 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005588
Domain Number - Region: 1900-1959
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0301
Family Apolipoprotein A-I 0.014
Further Details:      
 
Domain Number - Region: 487-547
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0389
Family PLC-like (P variant) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005588   Gene: ENSMPUG00000005633   Transcript: ENSMPUT00000005685
Sequence length 1968
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:2302870:2336743:1 gene:ENSMPUG00000005633 transcript:ENSMPUT00000005685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTEDWLITHRRYQHLSAAYSPITAETQRERQKGLTRQVFEQDTSGDERSGPEDSDDPRH
SSGSPEDTPRSSGASSIFDLRNLAADSLLPSLLERTAPEDVDRRNEAARRQHRPRALLAL
YPAPDEDEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISE
NFYFDLNSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISEC
CEPYMVMKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQPDRD
SDSEGERRPAWTDRRRRGPQDRTNSGDDTCSFSGFRPATLTVTNFFKQEAERLSDEDLFK
FLADMRRPSSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILE
FPAREVYAPHTSYRNLLYVYPHCLNFSSRQGSVRNLTVRVQYMAGEDPSQALPVIFGKSS
CSEFAREAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLLFTFYHVSCQPRPGTALETPV
GFTWIPLLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAV
SSVHPQDPHLDKFFTLVHVLEEGAFPFRLKDTVLSENTVEQELRASLAALRLASPEPLVA
FSHHVLDKLVRLVVRPPIIGGQIVNLGRGAFEAMAHVVSLVHRSLEAAQDARGHCPLLAA
YVHYAFRLPGTEPSLPSGAPPVAVQPATLARGPGRPASLYLARSKSISSSNPDLAVTPGS
VDDEVSRILASKGIDRSHSWVNSAYAPGGSKAVLRRAPPYCGADPRQLLHEELALQWVVS
GSAVREAVLQHAWFFFQLMVKSMALHLLLGQRLDTPRKLRFPGRFLDDIAALVGSVGLEV
ITRVYKDAELAERLNASLAFFLSDLLSLVDRGFIFSLVRAHYKQVSARLQSAPNPALLLT
LRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSVSSTTSQSSTFSSQAPDPKVTSMFEL
SGPFRQQHFLAGLLLTELALALEPEAEGASLLHKKAISAVHSLLCSHDADPRYAEASVKA
RVAELYLPLLSLARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIGGTINPSVAMAIA
GGPLAPGSRASISQGPVAASRSGYPLSAESSRTLLVCVLWVLKNAEPALLQRWAADLALP
QLGRLLDLLYLCLAAFEYKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRS
RERSPFGNQENVRWRKSVTHWRQTSDRVDKTKDEMEHEALVEGNLATETSLVVLDTLEII
VQTVMLSEARESILGAVLKVVLYSLGSAQSALFLQHGLATQRALVSKFPELLFEEDTELC
ADLCLRLLRHCGSRVSTIRMHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTTQS
FSEEHLRRSLKTILTYAEEDVGLRDSTFAEQVQDLMFNLHMILTDTVKMKEHQEDPEMLI
DLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCMVHAAALVAEYLALLEDSRY
LPVGCVSFQNISSNVLEESAISDDILSPDEEGFCSGKHFTELGLVGLLEQAAAYFTMGGL
YEAVNEVYKTLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQSSGWERVFGTYFRVGFYGA
RFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFGEDVVEIVKDSNPVDKTKLDPQKAY
IQITYVEPHFDTYELKDRVTYFDRNYGLRTFLFCTPFTPDGRAHGELPEQHKRKTLLSTD
HAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVG
PTVNQGPLEVAQVFLAEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEY
HRELERNYARLREALQPLLTQRLPQLLAPTTAGLRNSLNRASFRKADL
Download sequence
Identical sequences M3Y2N7
ENSMPUP00000005588 ENSMPUP00000005588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]