SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005592 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005592
Domain Number - Region: 404-441
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0867
Family Nuclear receptor ligand-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005592   Gene: ENSMPUG00000005637   Transcript: ENSMPUT00000005689
Sequence length 1134
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:583316:624523:-1 gene:ENSMPUG00000005637 transcript:ENSMPUT00000005689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMESSLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRVLIGMYNCAHEMLHGHSDPSFARLGQMV
LEYDQPLKKLTEEFGPHTKAVSEALLSLHFLFVRRSQGAEQWRSAQLLSLISTPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCNGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ
VHKVTEDLFSSWKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELESVLTDEPG
LLGPKALYVFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEEIRALVRR
HIKVIQQYHLQYLARFDALVLSDVIQNLSVCPEEESIIMSSFVSTLSSLNLKQVESGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENADLAKVMNLIVFHSRMLDSVENILVETSDLST
FCFHLRTFEKMFAMTLEEPTMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTVKQKQTPRKGEPERDK
PGAESHRKNRCIVTNMDKLHLNLTELALTMNHVHSFSVFEHTIFPSEYLSSHLEARLNRA
IVWLAGYNATTQEIARPSELLAGVKAYISFIQTLAQFVGVDVSRVIRNALLQQTQPLDSC
GEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFISLLREGEQNFSAEEFSDISEMRAL
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDVLVQIRSNFSKTDLMASLLPQLTG
ADNVLKRMTIIGVILTFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSVF
ELASAAGVGCDIDPALVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYS
IETDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTR
NRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAFHLNRVAASIH
Download sequence
Identical sequences M3Y2P1
XP_004774588.1.14098 ENSMPUP00000005592 ENSMPUP00000005592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]