SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005620 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005620
Domain Number 1 Region: 338-513
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.46e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000129
Further Details:      
 
Domain Number 2 Region: 515-615
Classification Level Classification E-value
Superfamily E set domains 7.28e-26
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005620   Gene: ENSMPUG00000005665   Transcript: ENSMPUT00000005717
Sequence length 831
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896946.1:6424235:6434059:-1 gene:ENSMPUG00000005665 transcript:ENSMPUT00000005717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSPPPRPAPSPGTWESQPARSVRLGGPGGASGGTGGGRVLECPSIRITSISPTPDPPAT
LEDNPDAWGDGSPRDYPPPEGFGGYRETGGQGGGPFFSPSPGSSSLSSWSFFSDASDEAA
LYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWNLYGPSPGGRGPEDSWLLL
SAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPPPPLPLARDPG
SPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPAPCNGKLQSGAEETAAPPGGPRK
EVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELRIEVQPRAHHR
AHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGK
MVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRV
RLVFRVHVPQGSGKVISVQTASVPIECSQRSAQELPQVEAYSPSACSVRGGEELVLTGSN
FLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSN
GRRKRSPTQTFKFLPVIFKEEPLPDSSLRGFPSAPGPPFGTDMDFSPPRPPYPSYPHEDP
AYETPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPETGGATGCARPPPVSFLPRPFPSD
PYGGRGSPFPLGLPFPPPAPFRPPLPSSPPLEGPFPPQSGIPPTPTEGYNEVGPSYGPGE
GAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPPA
Download sequence
Identical sequences M3Y2R9
ENSMPUP00000005620 XP_004755246.1.14098 XP_004755248.1.14098 ENSMPUP00000005620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]