SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005637 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005637
Domain Number 1 Region: 514-691
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-38
Family Phosphotyrosine-binding domain (PTB) 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005637
Domain Number - Region: 479-520
Classification Level Classification E-value
Superfamily SH3-domain 0.00584
Family SH3-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005637   Gene: ENSMPUG00000005682   Transcript: ENSMPUT00000005734
Sequence length 703
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896991.1:2145165:2153755:-1 gene:ENSMPUG00000005682 transcript:ENSMPUT00000005734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLVLKMDSSPDNDSWLEDQWERWLTHDISLEEFEDEDLSEITEECGISLQCKDTLSLRN
RKKGPLARTWEAKHGTRLQNPDLQQGVGDHPGGISSARQEETKGKAGTVGRGRCGRPKGP
TRLGSSRSRASSLGAGGRGPGQGGGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSW
QDRVSRSSSPLKTGEQTPPHEHICLSDELPPPSSPTATKDRGTSTDSPCRRSTATQMAPP
GGPTAAPPRRRSHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPPEPSSAFLPPAESRMS
VSSDPDPAAYPSAVGRPHPSISEEDEGFDCLSSPERPELQGGGWRGSLGEPPPPPRASLS
SDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPYESAIG
EEYEEAPRPRPPVCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCVINGEE
QEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVT
KEPEHMAALTKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSS
CVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHR
FACHVFVSEESTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE
Download sequence
Identical sequences M3Y2T6
ENSMPUP00000005637 ENSMPUP00000005637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]