SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005673 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005673
Domain Number 1 Region: 467-541
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000089
Family HMG-box 0.0021
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000432
Family HLH, helix-loop-helix DNA-binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005673   Gene: ENSMPUG00000005720   Transcript: ENSMPUT00000005772
Sequence length 584
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:4025511:4048680:-1 gene:ENSMPUG00000005720 transcript:ENSMPUT00000005772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGSSRHLYSLGWPRASSLGSSDRRQRKNHTSKLHELALLLPVALKTGTKKLTKKEILLH
VLHYIQHLQRSIDVAKTLLKFHTTNGEGGLRGLGRNWGSGPARRRHSTPSSSPHSRKSRL
QGACRKPRKKKPTGLSEGQSRAQNPRRCLDLDKLKKWVALSPEQQGRNTGGTVTPSRHAS
SCCHPKVASSLPQSDRKGGRSRLTLLDMAENSSHCDCSGCCCRVSAQGDGLYQAFKAQQG
AERIHFLNRTQPCPRQKLVFYDSSEDLDKESPDADPWLPAWTPEGSPTGSPLALGPPQIN
SCTMSGHPSAILGLSPSLFSSPGKLLPEQILGDGTEFLTQALFEDVFLDPESSPTGGVLE
GLQDEEMPPAPPEDPADSHSLCQSSVSLDHCYLSLSENSKAPSGSSSSWEGSEAESLWRR
QEDAQANPKGPLSSSDEDGDYTWTPTRRAASLPAAGRKVRKGPAKLKENKKASCPTQTKK
KCVNGFIMFCRMNRKQYIRACPGTASTAATKELAQLWRVMTQQERRPYCIKARRFSLQHN
RIVKQDSSSSEDEDWGTPKPFYQLLAEKARRSPDLAPLLPPQHH
Download sequence
Identical sequences M3Y2X2
ENSMPUP00000005673 ENSMPUP00000005673 XP_004767627.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]