SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005676 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005676
Domain Number 1 Region: 336-503
Classification Level Classification E-value
Superfamily PH domain-like 6.25e-36
Family Phosphotyrosine-binding domain (PTB) 0.0061
Further Details:      
 
Domain Number 2 Region: 526-658
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000107
Further Details:      
 
Domain Number 3 Region: 243-284
Classification Level Classification E-value
Superfamily WW domain 0.000000000117
Family WW domain 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005676   Gene: ENSMPUG00000005723   Transcript: ENSMPUT00000005775
Sequence length 708
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897276.1:317051:344249:1 gene:ENSMPUG00000005723 transcript:ENSMPUT00000005775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNSKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLMHLYSEL
ELSAHNAANRGLRGSGLIISTQEQGPDEGEEKAAGEAEEDDEEEDEEEEEEDLSSPQGLP
EPPESVEVPPRPQALADGPRDHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHREGFEDGEFWKDEPSEEAPMDLGLKDPEEGTLPFPAQSLSPEPLPQEEEKLPP
RNANPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIVSIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF
RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQK
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLG
ECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCL
DARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP
Download sequence
Identical sequences M3Y2X5
ENSMPUP00000005676 XP_004781233.1.14098 ENSMPUP00000005676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]