SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005724 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005724
Domain Number 1 Region: 98-186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000378
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005724   Gene: ENSMPUG00000005771   Transcript: ENSMPUT00000005823
Sequence length 207
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897048.1:5493897:5498839:-1 gene:ENSMPUG00000005771 transcript:ENSMPUT00000005823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQGDASD
IKDMSKFKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKK
AVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQMDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQVRKENSVDTASQAIK
Download sequence
Identical sequences M3Y323
ENSMPUP00000005724 ENSMPUP00000005724 XP_004769937.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]