SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005728 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005728
Domain Number 1 Region: 244-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.18e-46
Family Nuclear receptor ligand-binding domain 0.00000506
Further Details:      
 
Domain Number 2 Region: 119-203
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-27
Family Nuclear receptor 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005728   Gene: ENSMPUG00000005775   Transcript: ENSMPUT00000005827
Sequence length 508
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897048.1:5542858:5556688:1 gene:ENSMPUG00000005775 transcript:ENSMPUT00000005827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSYVTTSDGYCFAEPVQYYDILPEQINYQLHDTDFQESAYCQYSTVQFPTALQSQSLQ
SHFNTYSLDPQFGGGECVFGSYELNKPTYVVDHDAEDGYSGIKRPRLTHSSIRIKRQEEL
CVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYHCKNGGHCEMDMYMRRKCQECRLKK
CKAVGMLAECLLTEIQCKSKRLRKNFKQKNSFYSSIKVEEEGLDNKLVSSTTRAGKMIKE
SMELTQEEHQLINNIVAAHQKYTIPLEETKKFLQKYVNPELSFLRLSETVVLHLQGLMDF
TKGLPGFENLTAEDQTALCKGSKTEVMFLHGAQLYSQKECLSSASESPMRISDHSDHSLN
FPSQSDNRSVIYSMETFCNEDCPPTTLTGIAEEFITTLFCFYRRMSELNITNTEYALLAA
ITVFFSDRPYLKDKQHVENIQEPILQILYKYSKIYHPEDLQHFARLIGRLTELRTLNHNY
SEILSTWKAKDPKLASSLLEKWNLYSHC
Download sequence
Identical sequences M3Y327
ENSMPUP00000005728 ENSMPUP00000005728 XP_004769929.1.14098 XP_004769930.1.14098 XP_004769931.1.14098 XP_004769932.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]