SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005740 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005740
Domain Number 1 Region: 385-398,429-635
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 3.47e-36
Family Cofactor-dependent phosphoglycerate mutase 0.025
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily UBA-like 1.69e-16
Family UBA domain 0.00056
Further Details:      
 
Domain Number 3 Region: 257-321
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000494
Family SH3-domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005740
Domain Number - Region: 93-221
Classification Level Classification E-value
Superfamily LigT-like 0.000136
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005740   Gene: ENSMPUG00000005787   Transcript: ENSMPUT00000005839
Sequence length 649
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:10900710:11037550:1 gene:ENSMPUG00000005787 transcript:ENSMPUT00000005839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQYGHPGPLGMAAREELYSKVTPRRSRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELTPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYITKADECSTWIFHGSYSILNTASSNALSFGDSVLERRQYEDQGLGET
APLTIICQPTQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAYN
ILKGLQQENHLKIRVEPGLFEWTKWVPGNTLPAWIPPSELAAANLSVDTTYRPHIPVSKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
Download sequence
Identical sequences M3Y339
ENSMPUP00000005740 XP_004750144.1.14098 ENSMPUP00000005740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]