SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005757 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005757
Domain Number 1 Region: 80-286
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.87e-33
Family AlkB-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005757
Domain Number - Region: 8-51
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0968
Family Trimerization domain of TRAF 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005757   Gene: ENSMPUG00000005804   Transcript: ENSMPUT00000005856
Sequence length 297
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897008.1:1159706:1164748:1 gene:ENSMPUG00000005804 transcript:ENSMPUT00000005856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVFNSGIGGDTGGRLRGRCGWSLGQRGSLLSAHCVRVAFEMLRIRVLETKTGCMELVSM
EDEDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNW
GGLPHPRGMVPERLPLWLQRYVDKVSDLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYY
PTVSTISLGSHTMLDLYEPRQPKDDDLAEQPRSPPRPATSLLLEPRSLLVLRGTAYTRLL
HGIAAARVDALDAASLPPNAAACPSAQPGASLVRGTRVSLTIRRVPRVLRTGLLLSK
Download sequence
Identical sequences M3Y356
ENSMPUP00000005757 ENSMPUP00000005757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]