SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005761 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005761
Domain Number 1 Region: 126-200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000302
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005761   Gene: ENSMPUG00000005808   Transcript: ENSMPUT00000005860
Sequence length 391
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897008.1:1165351:1169170:1 gene:ENSMPUG00000005808 transcript:ENSMPUT00000005860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPPPLGPRPPSEPLNHPPGAPREPDIGGFTLCPASEERLRPDQAQKLGQDSLDPPQHL
QGGLGGTEPAAGPLRLPAPTSSEDAAAAKHCEHLSSGQEVLEAEQDSLALCLLGLGLRLR
DLERGLGPWASAQSRMGQLQALQADLRGAAERIDALLAFGEGLAQRSEPQARASLEQVLR
ALRAHRSSIFRRLWWLQAQLVSSSLVFEEASPLDQDLEVEGDLDGPGPGGIWGPWTPSSY
PTPAELEWDPAGDVGGLRPLWQKTAWTPGAPCELCGHRGPQGRGQGLEDMLMSGFSHWKH
LAGQRRRSLLRKSQDKKRASPNLQGVMLEVDPGAPPPASGHSLILLLLLLFLLLVGATLL
LPPSGGSCCSSARLAGTPYLVLSYVNGPPPI
Download sequence
Identical sequences M3Y360
ENSMPUP00000005761 ENSMPUP00000005761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]