SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005797 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005797
Domain Number 1 Region: 492-603
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-24
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 2 Region: 266-370
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-21
Family PDZ domain 0.015
Further Details:      
 
Domain Number 3 Region: 384-467
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family PDZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 694-735
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000578
Family PDZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005797   Gene: ENSMPUG00000005845   Transcript: ENSMPUT00000005897
Sequence length 738
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897409.1:152411:186140:-1 gene:ENSMPUG00000005845 transcript:ENSMPUT00000005897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMVSVEQTSSSSFNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPKNCLDL
SCIIYLCSNILASILFLFDFHNSDRKRIIKGSCKRIEVKYFPKILNKKLVRCCAVFNRRH
TRCEQKCFLKYFFMIRCPGASHRRLALERRKTDKGTLSLETDCSGTGTAPAERSLTSASL
PAWPEEPGLDNPAFEENTATDSMCSSPCFCFSSLFNRNRNFEAYCFLTKKSTASRILNRF
ISYKNSNFSINPSFPSHGYNTSSISYCSDQDPPLLFHGLPEGEITTIEIHRSDPYIQLGI
SIVGGNETPLINIVIQEVYRDGVIAKDGRLLAGDQILQVNNCNISNVSHNYARAALSQPC
STLHLTVLRERRFGGRTYSHPDSSSPREEVFHVVLHKRDSGEQLGIKLVRRTDEPGVFIL
DLLEGGLAAQDGRLSSNDRVLAINGHDLKHGTPELAAQIIQDSENNMYSMSEKETKEGPT
SPYLAVGQVAYNNRFPIPINKFLFSKDLTQCVTCQEKHITVKKEPHESLGMTVAGGRGSK
SGELPIFVTSVPPHGCLARDGRIKRGDILLNINGIDLTNLSHSEAVAMLKASAASSAVVL
KALEVQIVEEATQATEEQAGTFSENEYDSSWSPSWVMWLGLPSYYILKDKFLLLRRFSSG
PVGHCLVMGRKSSASLMQPLSFIKAQALGESLSRCGDMIVAVNGLSTMGMSHSALVPMLK
EKRNKVTLTVIYWPGSLV
Download sequence
Identical sequences M3Y396
ENSMPUP00000005797 ENSMPUP00000005797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]