SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005807 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005807
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.63e-89
Family G proteins 0.000000000248
Further Details:      
 
Domain Number 2 Region: 520-594
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-17
Family Pleckstrin-homology domain (PH domain) 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005807   Gene: ENSMPUG00000005856   Transcript: ENSMPUT00000005908
Sequence length 853
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:2646085:2741126:-1 gene:ENSMPUG00000005856 transcript:ENSMPUT00000005908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIKAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRNTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRGGLAES
TPTGIAVERGDVSTNKDAFLSWGRNPVLAGGLRLGVSVLSWDSSTALHSPQPSPRECAHI
RNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQA
QLNIIGDISTSTVSTPVPPPVDDTWLQSATSHSSHLSFLHSPTPQRRPVSSVHPPGRPPA
GAPGSKPGPAGPALPTLLRTWAAQPSPGRPLTRTTPSTPPPWAISHLAPGASSLVPEASA
PQPPPSPRPPRHP
Download sequence
Identical sequences M3Y3A6
ENSMPUP00000005807 ENSMPUP00000005807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]