SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005809 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005809
Domain Number 1 Region: 545-793,834-947
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 8.5e-128
Family Oxysterol-binding protein 0.00044
Further Details:      
 
Domain Number 2 Region: 9-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-42
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 238-310
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000616
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005809   Gene: ENSMPUG00000005858   Transcript: ENSMPUT00000005910
Sequence length 955
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:19102825:19320611:-1 gene:ENSMPUG00000005858 transcript:ENSMPUT00000005910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSEAEQHLLHHARNGNVEEVRQLLETMERNEVIADINCKGRSKSNLGWTPLHLACYFGH
RQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEYNADATVVNGSGQTAKEV
TYDKEIRNMLEAVERTQQRKLEEELLAAAREGRTAELIALLNRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCALKLLKSGADPNLKNKNDQKPLDLAQGAEMKHILISNKVVYKVLKRYEG
PLWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVRNIYRQGCKHLTQAVCTVKSTDSCLFF
IKCFDDTIHGFRVPKNSLQQSREENWLQNAFDHWILKTHICVGLDMLREEEWDSKSKTNI
KITLFSQKAQTCQQKLDREISTFLKMIKECDMAKDMLPSFLQKAEVVSEASRETCVALSD
CLNLFTKQEGVRNFKLEQEQEKNKILSEALETLATEHHELERSLVEGSPPRSILSEDEFY
DALSESESEQSLSRLEAITACSLEEEGEPLSSRKHRMSEGKDCGGGDALSNGIKKHRTSL
PSPMFSRNDFSIWSILRKCIGMKFSKITRPVIFNEPLSFLQRLTEYMEHTYLIHKASSFS
DSVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRLRDDLGFRLISEQVSHHPPI
SAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHGEAYTWTNPTCCVHNI
IVGKLWIEQYGNVEITNHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKW
TECLYSVDPATFDAYKKNDKKNTEEKKNSKQVSTSEESDEMPMPDSESVFVIPGSVLLWR
IAPRPPNSAQMYNFTSFAMVLNEVDKDMEGVIPKTDCRLRPDIRAMENGEIDQASEEKKR
LEEKQRAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWLYSGSYWDRNYFNLPDIY
Download sequence
Identical sequences M3Y3A8
ENSMPUP00000005809 ENSMPUP00000005809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]