SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005832 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005832
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PH domain-like 7.6e-46
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000132
Further Details:      
 
Domain Number 2 Region: 341-380
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000128
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005832   Gene: ENSMPUG00000005880   Transcript: ENSMPUT00000005933
Sequence length 382
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:4230988:4246036:-1 gene:ENSMPUG00000005880 transcript:ENSMPUT00000005933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETVICSSWATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGWKMQPEQQV
VINCAIVRGIKYNQATPSFHQWRDARQVWGLNFGSKEDAAQFAAAMASALEALEGGGPPP
PPPPAAPSTWSVQNGPTPEEVEQQKRQQPGPPEHMERRVSNAGGPPAPPAGGPPPPPGPP
PPPGPPPPPGAPSGVSAAGHGAGGGPPPAPPLPTAQGPSGGGTGAPGLAAAIAGAKLRKV
SKQEEASGGPSAPKTESTRSTGGGLMEEMNAMLARRRKATQVGEKPPKDESANQEEPEAR
VPAQSEPVRRPWEKNSTTLPRMKSSSSVTASEAHPSTPSSSDESDLERVKQELLEEVRKE
LQKVKEEIIEAFVQELRKRGSP
Download sequence
Identical sequences M3Y3D1
ENSMPUP00000005832 ENSMPUP00000005832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]