SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005870 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005870
Domain Number - Region: 26-78
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00845
Family Nuclear receptor ligand-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005870   Gene: ENSMPUG00000005920   Transcript: ENSMPUT00000005973
Sequence length 96
Comment pep:novel scaffold:MusPutFur1.0:GL896999.1:2368835:2386392:1 gene:ENSMPUG00000005920 transcript:ENSMPUT00000005973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRSKSPEPTTESDTGKVFNKCDVLTTPSAQSEEVILTPPPPRQEQPFSLPSMTEATTFT
PICILRTPPLRHWVGWTRAYISSTSKGAQESCLSGG
Download sequence
Identical sequences M3Y3G9
ENSMPUP00000005870 ENSMPUP00000005870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]