SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005886 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005886
Domain Number 1 Region: 884-1065
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 2 Region: 1040-1155
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.31e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 161-192,248-394
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-31
Family Phosphotyrosine-binding domain (PTB) 0.0062
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-21
Family Phosphotyrosine-binding domain (PTB) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005886   Gene: ENSMPUG00000005936   Transcript: ENSMPUT00000005989
Sequence length 1280
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896999.1:2479037:2696794:1 gene:ENSMPUG00000005936 transcript:ENSMPUT00000005989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPNEPSVDFSLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSKKEPG
ARQVRLCVSPSGLRCEPEPGKSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKD
HTASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELRCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFKHVSGRRRAEFDVGSPRSESPRPAAGPSLPERVPPGPPAG
DGEPGRGPMRKSFSQPGLRSLAFRKEFQDGSLRSRSFFSSFEENDIENHLISGHNVVQPT
DMEENRTMLFTIGQSEVYLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGG
GFHFVCYVFQCTNEALVDEIMLTLKQAFTVAAVQRTAQVPAQLCEGCPLQGLHKLCERIE
GMNSSKTKLELQKHLTTLSNQEQATIFEEVQKSRPRSEQRENELIISFLRCLYEEKQKGH
VHIGEVKQTSQITAENIGSELPPSATRFRLDMLKNKAKRSLTESLESILSRGSKARGLQE
PSASLDLDSSTSSTLRNTSKEPSVCDREALPTPESSFRLLGSSEDLSSDPESHPAEEPAP
LSPRQSFRRRANTLSHLPVECQEPLEPAQGSPGVSQRKLLRYHSVSTETPRDRNVNHPAV
GESKSCSGQSSAPAPPSRLNPSASSPNFFKYLKHSSSGEPSGNAVPKSISYRNALRKKLH
SSSSVPNFLKFLAPVDENNTSDFMNTKSDFDSKANHLGDGSRTPVKTRRHSWRQQIFLRV
ATPQKACDSPSRYEDYSELGELPPRSPLEPVCEDRPFCPVPEEKKRTSRELRELWQKAIL
QQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFD
MEKMHSAVGQGVPRHLRGEIWKFLAEQCRLQYQFPSKQQPKDMPYKELLKRLTSQQHAIL
IDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMGEEEA
FTMLKFLMFEMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPW
FLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNT
LPNLGLVQMEKTISQVSEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKTNSS
LRKQNLDLLEQLQVANGRIQSLEATVEKLLSSESKLKQATLALELERSALLQTVEELRRQ
GMAEPHRPEPDFMGPRPAGD
Download sequence
Identical sequences M3Y3I5
XP_004764039.1.14098 ENSMPUP00000005886 ENSMPUP00000005886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]