SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005888 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005888
Domain Number 1 Region: 440-553
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-26
Family PDZ domain 0.0024
Further Details:      
 
Domain Number 2 Region: 581-686
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-25
Family PDZ domain 0.0000599
Further Details:      
 
Domain Number 3 Region: 248-363
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000945
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005888   Gene: ENSMPUG00000005938   Transcript: ENSMPUT00000005991
Sequence length 1356
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897093.1:1327798:1879623:-1 gene:ENSMPUG00000005938 transcript:ENSMPUT00000005991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWCCAALTQTPHSVGCAGLECRGHRAQLGNCLSCLPRRRLKDPNYWIQVHRLEHGDGGI
LDLDDTLCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQP
YQATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSISDNNFSSEEPSRKNPTRWSTTAG
FLKQNTAGSPKTCDRKKDENYRSLPRDASNWSHQFQRDNARSSLSASHPMVDRWLEKQEQ
DEDGTEEDNSRVEPVGHADTGLENIPSFSLDDMVKLVRVPNDGGPLGIHVVPFSARGGRT
LGLLVKRLEKGGKAEQEKLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMCTPIIWFHVV
PAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSMHSAGLSALQRAPRPNPLSEPTDSH
PRLLPQSTHPSGKPPSAPAPVPQNVFSTNVSSGYNTKKIGKRLNIQLKKGTEGLGFSITS
RDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDIAGKSQEEVVSLLRSTKME
GTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKGEDEDIVLTPDGTREFLTFEVPLNDSG
SAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQD
AMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPSGPELPIETVLDDRERRISHS
LYSGIEGLDESPTRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFMTMDAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGR
ESVSTASDQPSHSLERHMNGNQEKGDKMDRRKDKAGKDKKKDRDKEKDKMKAKKGMLKGL
GDMFRFGKHRKDDKIEKTGKIKIQDSLTSEDERIRMKQEQERIQAKTREFRERQARERDY
AEIQDFHRTLGCNDELMYGGMSSYEASMALNARPQSPRGDMMDALYAQVKKPRHSKPSSV
DSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNSRAAAQSGRHSVSVEV
QMQRQRQEEREGFQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYSS
YQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPPPEGLNNYDSYKKVQDPS
YTPPKGPFRQDVPPSPSQVARLNRLQTPEKGKPFYS
Download sequence
Identical sequences M3Y3I7
ENSMPUP00000005888 ENSMPUP00000005888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]