SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005924 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005924
Domain Number 1 Region: 637-757
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-24
Family Ankyrin repeat 0.0000101
Further Details:      
 
Domain Number 2 Region: 587-606,767-824
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-17
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005924   Gene: ENSMPUG00000005975   Transcript: ENSMPUT00000006028
Sequence length 835
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:4332102:4347571:1 gene:ENSMPUG00000005975 transcript:ENSMPUT00000006028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEAFQSTRDLLDLNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPTPPGSQ
AGAPPRPSRYSSSPVPESFSSRGSPRKAATDGADTPFGRSESAPALHPYSPLSPKGRPSS
PRTPLYLQPDAYGTLDRAPSPRPRAFDGTGSSLGRAPSPRPGSGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPQTSAYDASVAFGSPLLGAGGSAFAPPLRAQDDLT
LRRRPPKAWNESDLDVAYEKKSSQTASYERLDIFSRPASPGLQLLPWRESSLDGLGATSK
DNLTSATLPRNYKVSPLANDRRSDVGSYRRSLGSPAPSGTLPRSWQPVSRIPMPPSSPQP
RGAPRQRPIPLSMIFRLQNAFWEHGASRAMLPGSPIFSRAPPPKLPPQPQAPPQPQAPPQ
PQPPPQPQPPPPPQPQPQPQPQPPVPAPQPPQQTWPSVSEGPPKPPPELEPEPELEGLLA
PVLEGGDADEGAVTRPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQSP
AVALPPTHKKQYQQLISRLFHRHGGPGGPEPELSSISEGSEARAGPPAPAPPAPIPPPAL
PQVSPPEQLQSMEMRSVLRKAGSPRKVRRARLNPLVLLLDAALTGELDVVQQAVKEMNDP
SQPNEEGITALHNAICGANYPIVDFLIAAGANVNSPDSHGWTPLHCAASCNDTAICTALV
QHGAAIFATTLSDGATAIEKCDPYREGYADCATYLADVEQSMGLMHNGAVYALWDYSAEF
GDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKTQRNKV
Download sequence
Identical sequences M3Y3M3
XP_004767653.1.14098 XP_004767654.1.14098 XP_004767655.1.14098 XP_012919440.1.14098 ENSMPUP00000005924 ENSMPUP00000005924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]