SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005982 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005982
Domain Number 1 Region: 853-992
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.26e-48
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0000751
Further Details:      
 
Domain Number 2 Region: 585-841
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.69e-32
Family Extended AAA-ATPase domain 0.0000142
Further Details:      
 
Domain Number 3 Region: 402-479
Classification Level Classification E-value
Superfamily BRCT domain 9.74e-18
Family DNA ligase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005982   Gene: ENSMPUG00000006033   Transcript: ENSMPUT00000006087
Sequence length 1155
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896999.1:3648399:3726728:-1 gene:ENSMPUG00000006033 transcript:ENSMPUT00000006087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIRKFFGVIPSGKKPVTETVKKNEKTRSAEETLKAKKGIKEIKVNSSCKEDDSKQKQPN
KKKRIIYDSDSESEETVQVKNAKKQPEKLPLSSKPGKILRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSYLGASHMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSEKK
MVASKRKEPSQNADDSRLNDEAIAKQMQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDPGEREAFSSVQANLSKAEKHKSPYKVKTEQFSDDRKNCSPKKQSKCESLIGSQQHL
KSSPHKIGETSPKASSKVALLKKRGESSYKETEPMASKRKENAVELKGQTKTPKKPKSSP
AKKESVSPEDSEKRRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLTFVITGVLESI
ERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTNIIDEDGLLNLIRT
MPGKKSKYEIAVEAEMKKEKSKLERTPQKKDQGKRKISPTKKESESKKSRLTPKKDSTTK
SPKKGTGVFWRCLDFEEQVAEETDGDSQARNLADDSSEKNKVEHLLWVDKYKPTSLKTII
GQQGDQSCANKLLRWLQNWHRSPSEDTKRAAKFGKFAGKDDGSSFKAALLSGPPGVGKTA
TAALVCQELGYSYVELNASDTRSKNSLKEIVAESLNNTSITGFYSTSQHGSGGPTHSIST
KHALIMDEVDGMAGSEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQ
RPRVEQIKGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQA
KADSHRAKKDIRLGPFDVARKVFAAGEETAHMSLMDKSDLFFHDYSIAPLFVQENYVHVK
PVAAGGDMKKHLMLLSRAADSICDGDLVDRQIRSKQNWSLLPTQAIYASVLPGELMRGYM
TQFPTFPSWLGRHSSTGKHDRIVQDLALHMSLRTYSSKRTINMDYLSHIRDALVQPLTSQ
GVEGVQDVIALMDAYYLMKEDFENIMEISNWGGKPSPFSKLDPKVKAAFTRTYNKEVHLI
PYSLQAVKTPRHSTGPALDSEYNEELNEDDSQSDEKDQDSMETDAMIKKKTKSSKPSKSE
KDKESRKGKGKSSKK
Download sequence
Identical sequences M3Y3T1
XP_004764068.2.14098 ENSMPUP00000005982 ENSMPUP00000005982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]