SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005995 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005995
Domain Number 1 Region: 13-161
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 4.71e-50
Family Troponin I 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005995   Gene: ENSMPUG00000006046   Transcript: ENSMPUT00000006100
Sequence length 182
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:8574570:8576626:-1 gene:ENSMPUG00000006046 transcript:ENSMPUT00000006100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDSEEKRNRAITARRQHLKSVMLQIAATELEKEEGRRESEKQNYLSEHCPPLHLPSSMSE
VQELCKQLHAKIDAAEEEKYDMEVRVQKSTKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFET
ES
Download sequence
Identical sequences M3Y3U4
ENSMPUP00000005995 ENSMPUP00000005995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]