SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006005 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006005
Domain Number 1 Region: 915-1106
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00083
Further Details:      
 
Domain Number 2 Region: 63-97
Classification Level Classification E-value
Superfamily WW domain 0.000000117
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006005   Gene: ENSMPUG00000006056   Transcript: ENSMPUT00000006110
Sequence length 1111
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897203.1:211919:304475:1 gene:ENSMPUG00000006056 transcript:ENSMPUT00000006110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTRDYECESHDAGAQEPRVAGSSTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR
IKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQDCDIIPLAKLQTLKQNTESPRASA
ENSPGRASSVSREGSTSSSLEPELDAGEKAQEPVGRASRQAAFGALKEESGSSSPPGVFL
EKDYEIYRDYNADGQLLHYRTSSLRWNSGTKERMLIKVADREPSFLSSQGNGYALDSHAG
SRSRRPSGGQHSPSLQTFAQDSDGPVFFPERRPSPFLKRAELGSCSPLLAQPRKPTSDSQ
PSSPRYAYEPPLYEEPPVEYQAPIYDEPPMDVQYEAGGGYQAASPQRSPGRKPAPFPQAP
KQGSSPSQQLVLTRQRCPDRFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAPS
PGGGSLPLQPSPCLLRDQRLGVSSGDYSSMEGPEPRHTQPPMQVPQAQDDTMSWSSQQDT
MSSTSYSPGTRKRKSRNASLCRAPSTSAAEGAGDRDLLGEQPLAEERPLCGPSLAPVKRA
EGKTGEAEPFLAQARLAWEAQQAHFHMKQRGSWDSQQDGSGYESDSAVPLPMPGPVVRAF
SEDEALAQQDGKHWQRGALERLAFPQILLEKSVSVQTNLASPEPYLHPSQSEDLGSCAQF
ESSRQARSVMPSASCVFPPFTLRKPSSETDIENWASKHFNTHTQGLFRRKVSIANMLAWS
SESIKKPMIVTSDRHVKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSVQGLRDE
LYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKVTR
HMKALLERNTKKKSKLRKKPKPYVEEPHGVAISTYAKYCYHKLQKAALTGAKKGLKKPNV
EEIRHAKNAVFSPSMFGSGLQEVMNMQKERYPERQLPWVQTRLSEEVLALNGDQTEGIFR
VPGDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYEN
PEAAVAVVHALPRINRLVLCYLIRFLQVFVQPANVAITKMDVSNLAMVMAPNCLRCRSDD
PRVIFENTRKEMSFLRVLIQHLDTSFMEGVL
Download sequence
Identical sequences M3Y3V4
ENSMPUP00000006005 XP_004779436.1.14098 XP_012904879.1.14098 ENSMPUP00000006005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]