SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006032 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006032
Domain Number 1 Region: 229-358
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-30
Family Synaptotagmin-like (S variant) 0.000086
Further Details:      
 
Domain Number 2 Region: 99-227
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.68e-30
Family Synaptotagmin-like (S variant) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006032   Gene: ENSMPUG00000006083   Transcript: ENSMPUT00000006137
Sequence length 391
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:8578937:8581117:-1 gene:ENSMPUG00000006083 transcript:ENSMPUT00000006137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPLGPHSTPAPASTTAIPGLIPDLIARLPWPRWAIIVIAVAAGVLMVSCLLCAVCCCC
RRGHRKKPRDREAVGLGSPQGTTSSHLVQPDVDTSETAPEDAQHWGRLQLSLEYDFSRQE
IKVGLKQAADLRACGPGGTADPYARVSLPTQAGHSHETRVHRGTLCPAFQETCCFHIPQE
ELAGATLRVQVLGSKRFSAPEPLGELSLPLGAVDLQHVLEQWYQLGPPGAAEPEPSGELC
LSLRYVPSSGRMTVVVLEARGLSPGLADPYVKVQLMLNQRKWRKRKTSARKGTASPYFNE
AFTFLVPFSQIQSVDLVLAVWARGPQFRAEPVGKVLLGARASGQPLQHWADMLAHARRPV
AQWHPLRPAREVDRALGLKPRLHLTLPGSRD
Download sequence
Identical sequences M3Y3Y1
XP_012915501.1.14098 ENSMPUP00000006032 ENSMPUP00000006032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]