SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006057 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006057
Domain Number 1 Region: 618-718
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000633
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006057   Gene: ENSMPUG00000006108   Transcript: ENSMPUT00000006163
Sequence length 762
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:7702809:7714946:1 gene:ENSMPUG00000006108 transcript:ENSMPUT00000006163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGEEKAEVEASVDTKTPSYGQWSCREQEVDIVGLVSREQEPPLCLEAEARTASPVWGT
EGLSAPPCCDGADPSPSASCQPQANASSREPVAGRAQLALGCLPPPAGAGTRDLLHSVGS
QMEETRLSASEDLPQALSVPRATGLCSGHDADSEDDSSPVESPRALDLSQQPHYSGFPFP
PRWRPLASQAAPAPQFSSCSVSASSLGSLQGHREKAEPPGCSIAKVSSSLQLVVPPLTPS
VVGPGLQWSPQPPSSGVDAPGLGRRRLSFQAEYWACVLPDSLPPSPDRHSPLWNPNKEYE
DLLDYTYPLRPKPQHPKHLDSHTLADPVLQDSGVDLDSFSVSPASTLKSPTNGSQNCPSA
EAFLPFSRPREPSLMRSPSGVPQKQGSLGLASCNQLASTPRAPGRRDAPWESREPALRGV
KDWLPVGRHLEVGSPQLKTWDRGWSLPRTEREKGASRGAWHPACTESRWKSEEELESDDE
YLALPTRLTQVSSLISHLGSIPTLVTLPTGAAKGQTSLDPSDSDRPASLPSDSSQSQLPS
GTVFRGPRGPEGQNHCLLHSFVQARGPGGDGCLGSSQALGVSGLLRAHSSLPAVWDQCAC
LDPDATGQPLGKGEQGKESLMQCVKTFCCQLEELIRWLYNVADVTDHLIPSKPNLTGLKS
SLQLYRQFKKDIDEHQSLTESVLQKGEILLQCLLDNTPVLKDVLGRISKQPSELESHADR
LYDAILASLDMLAGCTLIPDNTPVAPKSTGVKGMSLASQADM
Download sequence
Identical sequences M3Y406
XP_004742131.1.14098 ENSMPUP00000006057 ENSMPUP00000006057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]