SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006062 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006062
Domain Number 1 Region: 139-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-77
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 86-170
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.48e-33
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006062   Gene: ENSMPUG00000006113   Transcript: ENSMPUT00000006168
Sequence length 458
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:1787495:1810716:1 gene:ENSMPUG00000006113 transcript:ENSMPUT00000006168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNKERLFAAGGLGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSLDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPKASGEDEVPRGQGKGGCSPQPDQGP
Download sequence
Identical sequences M3Y411
XP_004774691.1.14098 XP_004774692.1.14098 XP_004774693.1.14098 XP_004774694.1.14098 XP_012902350.1.14098 ENSMPUP00000006062 ENSMPUP00000006062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]