SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006069 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006069
Domain Number 1 Region: 312-441
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 443-548
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-23
Family Third domain of FERM 0.0071
Further Details:      
 
Domain Number 3 Region: 40-135
Classification Level Classification E-value
Superfamily PDZ domain-like 7.32e-16
Family PDZ domain 0.027
Further Details:      
 
Domain Number 4 Region: 225-306
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000056
Family Ubiquitin-related 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006069   Gene: ENSMPUG00000006120   Transcript: ENSMPUT00000006175
Sequence length 1622
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:3173020:3313357:1 gene:ENSMPUG00000006120 transcript:ENSMPUT00000006175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGTPGIPIQTLTPVKHTVKI
DKDALLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQMNNEPAESLSCERAVNIL
REAEDSLSITVVRCTSGDYRRPYQILCKNEGILLYPQDPALPIWNPIFKRKMNSVASDLF
WGVPKSSFLTEEKRARLKTNPVKVHFAEEVLVSGHSQGSSLLCMPNVLKLYLENGQTKAF
KFEANTTVKDIILTVKEKLSIRSMEYFALALEEQYNISRLHLLHEEELIQQVVEREESHD
YRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEMKCSSALRLAALHIQE
RIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISFHMKRNQNLLEPRQKQ
LISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYIALLVGAKYGISQIISSKLNIM
STLAEFANISRVELTEESEKVSMVKVYLQDVKVLTLLLESNSAKDLACLIAGYYRLFVDP
DTPIFLWPGNKQQVHRVSAEEGYESRACSDSEESSEVDCMPEPLCDGHLPKLDPGRPHVK
EELPPGDSPRPEVARRGPSISGASMTDSAESEASDSANTESRGCRTSGSSESMEALEEDD
LDACSSSRSGFFRSSAPGFPETPSSNSQDERSRIETRGFLCLLDLAQRASPLCPKTEFPE
SPAPDTFSWGPELSAARLDPRLYEGSRPDYYSLCSSVSLASHLSDSSESTASRQGGGLPA
WAQQGWTEAQPCSALEALAPHLPLALEDGSSDEEYYDAADKLTPPDALAGPRAVPAAEPS
ATSLKNKASTYAPEDSLNPGPDGREPCRRGGAKKYAKTLRKRRSFLQTDYTCQVSFPLVP
SASLESVDDVCYYNREPYLALSAPSPTVSSLQDMQGEPGLLETKALGLLGPLRKTKSKNP
ASRVMEMEPETMETKSVIDSRVSSISAIRLRIDPNHKESSGDAPPTATVANSPANTLPCS
NPGSSGADNVQAEPSQTLSSFQQSDGNAPKELTLELGDGTSSLSSADPDTDRGCLPISPG
PRDASQADTLEPGGVRLETGLGSLFTNPMQETAPKCTEPPLSPPVTPGSECTINSGEKTA
SFPMEEEQPEQLPLGHDGEVTNKNGTSLFHDGSGQDSGDAKGDLSNAVPQTTGVSAPAGR
IVASLSLKSLITETEQILPHSPMDPKGQSRETLSQACQAQDQKLLEELDLDPDFLLGDQT
IPSVFPLEGVKTKPLNHVTGEDTTPRDPVQQISFNPGPSLPKALACPQKEPHLEGSNHCS
LSENKSKIPSVSLPTEKSFLCFAPESHPKVPARLRMATSLGFVGANETVAPRIGMEQCSC
QFSYATCFRGLQPDAEEEDRDLEVHPTAPLTSPPSAGSRLALPWRPARAHSCSTEPLSRR
SHIWPEYCSRALRQLKAVPASSPEGFMQLTESLLELQDILEASWGNGNRHPPEKCSWHFL
ESRSRLCMGSQKLLSSCQHVIRMDQSPEEMQGAVRDTFQHLVQLASLCFQFTDCGRCSSR
HREAAGNLRDVVYTYHQFVEAAKLTCERGYHDLSVKLLARQCTALTAAVFCLTQKFRASA
AL
Download sequence
Identical sequences M3Y418
ENSMPUP00000006069 ENSMPUP00000006069 XP_004747682.1.14098 XP_004747683.1.14098 XP_004747684.1.14098 XP_004747685.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]