SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006112 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006112
Domain Number 1 Region: 226-355,610-725,1074-1187
Classification Level Classification E-value
Superfamily TPR-like 2.8e-96
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006112   Gene: ENSMPUG00000006164   Transcript: ENSMPUT00000006219
Sequence length 1198
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896991.1:4226303:4347399:-1 gene:ENSMPUG00000006164 transcript:ENSMPUT00000006219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVGVRGRCELPPCSGPGWLLSLSALLSVAARGAFATTHWVVTEDGKIQQQVDSPMNL
KHPHDLVILMRQETTVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVP
LGDLDLYDGTYITLESKDISPEDYIDTESPVPPDPEQPDCTKILELPYSIHAFQHLRGVQ
ERVNLSAPLLPKEDPIFTYLSKRLGRSIDDIGHLIHEGLQKNSSSWVLYNMASFYWRIKN
EPYQVVECAMRALHFSSRHNKDIALVNLANVLHRAHFSADAAVVVHAALDDSDFFTSYYT
LGNIYAMLGEYNHSVLCYDHALQAKPGFEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLN
ELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHS
LHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQANQSDISDLVKSSPVAHS
ILWIWGRDSDAYRDKQHILWPKRADCAESYPRVPLGGELPTYFLPPENKGLRIHELSSDD
YSSEEEAQTPDCSITDFRKSQTLSYLVKELEVRMDLKAKMPDDHARKILLSRINNYTIPE
EEIGSFLFHAINKPNAPVWLILNEAGLYWRAVGNSTFAIACLQRALNLAPLQYQDIPLVN
LANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYLALKNISGALEAFRQALKLTT
KCPECENSLKLIRCMQFYPFLYNITSSVCSGNCHEKTLDNSHDKQKYFDNSQSLDAAEEE
TSETGTEEEPVLSVENSGRDSDALRLESTVAEESNGSDEMENSDETKMSEEILALVDEFQ
QAWPLEGFGGALEMKGRRLDLQGIRVLKKGPQDGVARSSCYGDCRSEDDEATEWITFQVK
RVKKPKGDHKKTPGKKVEQNQAENVHRYQANLEITGPKVASPGPQGKKRDYQSLGWPSPD
ECLKLRWVELTAIVSTWLAVSSKNIDITEHIDFATPIQQPAMEPLCNGNLPTSMHTLDHL
HGVSNRASLHYTGESQLTEVLQNLGKDQYPQQSLEQIGTRIAKVLEKNQTSWVLSSMAAL
YWRVKGQGKKAIDCLRQALHYAPHQMKDVPLISLANILHNAKLWNDAVIVATMAVEIAPH
FAVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEFVPAKNRIQTIQCHLMLKKGRRSP
Download sequence
Identical sequences M3Y461
ENSMPUP00000006112 XP_004763268.1.14098 ENSMPUP00000006112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]