SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006134 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006134
Domain Number 1 Region: 12-124
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006134   Gene: ENSMPUG00000006186   Transcript: ENSMPUT00000006241
Sequence length 417
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:7928432:8043207:-1 gene:ENSMPUG00000006186 transcript:ENSMPUT00000006241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHCHLEQPMPRPYRQVSFPDDDEEIVRINPREKIWLTGYEDYRHAPVRGKS
PDTSEDADSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGGVIKTQPSRGKSRRRK
EDGERSRCEYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDY
TDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAV
Download sequence
Identical sequences M3Y483 U6CQR5
XP_004742137.1.14098 ENSMPUP00000006134 ENSMPUP00000006134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]