SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006137 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006137
Domain Number 1 Region: 1266-1394
Classification Level Classification E-value
Superfamily PH domain-like 8.88e-47
Family Phosphotyrosine-binding domain (PTB) 0.0000003
Further Details:      
 
Domain Number 2 Region: 297-424
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-35
Family PLC-like (P variant) 0.0043
Further Details:      
 
Domain Number 3 Region: 129-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.58e-26
Family Dual specificity phosphatase-like 0.00026
Further Details:      
 
Domain Number 4 Region: 1114-1261
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 24-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000508
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006137   Gene: ENSMPUG00000006189   Transcript: ENSMPUT00000006244
Sequence length 1449
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:1927435:1940620:-1 gene:ENSMPUG00000006189 transcript:ENSMPUT00000006244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSGPVERLLRALGRRDSSRASNRPRKAEPHSFREKVFRKKPPVCAVCKVTIDGTGVSC
RVCKVATHRKCEAKVTSSCQALPPAELRRNTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGSKGKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVAAELQPSQHRYISYFSGLLSGSIRMNSS
PLFLHYVLVPVLPAFEPGTGFQPFLKIYQSMQLVYTSGIYHITGPGPQQLCISLEPALLL
KGDVMVTCYHKGGRGTDRTLVFRAQFHTCTIHGPRLTFPKDQLDEAWADERFPFQASVEF
VFSSSPEKIKGNTPRNEPSVSVDYNTAEPAVRWDSYENFNQHHEDSVDGSPTHTRGPLDG
SPYAQVQRAPRQTPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPAAESPGRPPPTAAERQE
LDRLLGGCGVASGGRGAGRETAILDDEEQPPTGAGPPLGMYSGHRPGLSRHCSCRQGYRE
PCGVPNGGYYRPEGTLDRRRLAYGGYEGHPQGYTEASVEKRRLCRSLSEGPYPYPPELGK
PATGDFGYRAPGYREVVILEDAGLPALCSCPACEEKLALPTAALYGLRLEREAGEGWAGE
AGKPLLHPVRTGHPLPLLVPACGHHHAPMPDYSCLKPPKAAEDGHEGCSYAMCPENRYGH
PGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPAEGRGYPSSGVHSPRAGSISPGSPPYPQ
SRKLSYEIPAEEGGDRYPMPGHLAPAGPLASAESPEPGSWREGPSGHSTLPRSPRDAPCS
ASSELSAPSTPLHTSSPVQGKESTRRQDTTSSPTLVPTQRLSPGEALPSVPQGGAEKAPE
LPGRSGLELPVPSPFSPTSPPSSPSDWPQEKSPGSRSDGASPRGPVPTTLPGLRHAPWQG
LRDPPDSPDGSPLTPVPTQMPWLMASSEPSQSSPTPAFPLAASYDINGPTQPPLPEKRHL
LGPGQQPGPWSSEQASPPARGTSHHVTFAPLLSDNVPQPPEPPMQESQSNVKFVQDTSKF
WYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPLEQLV
RHFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPSKDPLEETPEAPV
PANMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRATPAIVHFKVS
AQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWANPDGTTSKIFGFVAKKPGSPWEN
VCHLFAELDPDQPADGRDGRVKGEEAAVGTLEGISGQPRLQENISLEGEPGLPALPSGRS
QPGRERRKR
Download sequence
Identical sequences M3Y486
ENSMPUP00000006137 ENSMPUP00000006137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]