SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006140 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006140
Domain Number 1 Region: 576-709
Classification Level Classification E-value
Superfamily PH domain-like 8.5e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000543
Further Details:      
 
Domain Number 2 Region: 392-552
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-35
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 
Domain Number 3 Region: 284-322
Classification Level Classification E-value
Superfamily WW domain 0.000000000167
Family WW domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006140   Gene: ENSMPUG00000006192   Transcript: ENSMPUT00000006247
Sequence length 759
Comment pep:known scaffold:MusPutFur1.0:GL896999.1:4940319:5199617:-1 gene:ENSMPUG00000006192 transcript:ENSMPUT00000006247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVLPADSGVDPVAVFMASSGATDITNRNSPATPPNTLHLRSSHNELLNAEIKHTETKN
STPPKCRKKYALTNIQVAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNK
NVSPTAVINITSEKLEGKEPHPRDSSGCEILPSQPRRTKSFLNYYADLETSTRDLEQSVG
NQHGAVEEKSQPGQGPASTIIGNGEALPQKPNKAQFSPEDGPAATVSSSPETKKDHPKTG
AKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETADIWSDHSFQTDPDLPPGWKRI
NDIAGTYYWHIPTGTTQWERPVSIPGDRHGSRKGSLSSVTSSPTPEHEKQPWSDFAVLNG
GKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRHAPHAEEDDSCSINSDPEAKCF
AVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDTL
SLVDPMDRSVLHSQPIASIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIAT
SLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLP
VDKPVGMDTLNNAIENLMTSSNKEDWPSVNMNVADATVTVISEKSEEDVLVECRVRFLSF
MGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKV
RPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP
Download sequence
Identical sequences M3Y489
ENSMPUP00000006140 ENSMPUP00000006140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]