SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006143 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006143
Domain Number 1 Region: 19-131
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.22e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006143   Gene: ENSMPUG00000006196   Transcript: ENSMPUT00000006251
Sequence length 471
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897045.1:4122248:4295846:1 gene:ENSMPUG00000006196 transcript:ENSMPUT00000006251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVEKNKLEKEKEKKKEEKKKEKE
PEKPTKPLTTEKLQKKEDQQLEPKKSTSPKKAAEPTVDLLGLDGPAEAPVTNGNATTVPS
LNDDLDIFGPMISNPLPATVVPPAQGTPSIPAAATLSTVISGDLDLFTEQTTKSEEVAKK
QLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPTAFQGFPSMGVPVPTPAAPGLL
GNVMGQSASMMVGMPMPNGFMGNAQTSVMPLPPNVVGPQGGMMGQMGAPQSKFGLPQAQQ
PQWNLSQMNQQMAGMSISSTTPTVGFGQPPNTTAGWSGSSSGQTLSTQLWK
Download sequence
Identical sequences M3Y492
XP_004769363.1.14098 ENSMPUP00000006143 ENSMPUP00000006143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]