SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006177 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006177
Domain Number 1 Region: 47-106
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000177
Family SIAH, seven in absentia homolog 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006177
Domain Number - Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.0506
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006177   Gene: ENSMPUG00000006230   Transcript: ENSMPUT00000006285
Sequence length 274
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897203.1:388112:394998:1 gene:ENSMPUG00000006230 transcript:ENSMPUT00000006285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPR
SLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQ
SHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARV
NDSERNPNLSCKRTLSFQLLLKSKVTAPLECSFLLLKGPYDDVKISPVIYHFVFTNESNE
TDYVPLPIVDSVECNKLLAAKNINLRLFLFQIQK
Download sequence
Identical sequences M3Y4C6
ENSMPUP00000006177 ENSMPUP00000006177 XP_007091578.1.5354 XP_012417937.1.74151 XP_019290704.1.44245 XP_021544217.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]