SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006192 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006192
Domain Number 1 Region: 678-1033
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.77e-93
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000961
Further Details:      
 
Domain Number 2 Region: 482-674
Classification Level Classification E-value
Superfamily ARM repeat 3.45e-57
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000472
Further Details:      
 
Domain Number 3 Region: 106-285
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-49
Family Ras-binding domain, RBD 0.0046
Further Details:      
 
Domain Number 4 Region: 327-477
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.19e-48
Family PLC-like (P variant) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006192   Gene: ENSMPUG00000006245   Transcript: ENSMPUT00000006300
Sequence length 1044
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:149024:199248:-1 gene:ENSMPUG00000006245 transcript:ENSMPUT00000006300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGVDCPMEFWAKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLHDPEVNAFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSSKDVPLALMACALRKKATVFRQPLVEQPEDYA
LQVNGKHEYLYGSYPLCQFQYICSCLHSGQTPHLTMVHSSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECRLYMWPSVPDEKGELLNPAGTVRSNPNTESAAALVICLPEVAP
YPVYYPTLDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHLCLR
QETYLEALSHLQSPLDPSTLLADVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
Download sequence
Identical sequences M3Y4E1
ENSMPUP00000006192 ENSMPUP00000006192 XP_004768663.1.14098 XP_012920046.1.14098 XP_012920047.1.14098 XP_012920048.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]