SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006196 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006196
Domain Number 1 Region: 256-365
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.07e-21
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 
Domain Number 2 Region: 400-603
Classification Level Classification E-value
Superfamily vWA-like 7.56e-20
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 3 Region: 116-234
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.31e-17
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006196   Gene: ENSMPUG00000006249   Transcript: ENSMPUT00000006304
Sequence length 655
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896946.1:6692053:6699886:-1 gene:ENSMPUG00000006249 transcript:ENSMPUT00000006304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVTVSVGVLPLSHPQPALLPRFCGSLPGNGPAPPLFSLPTGLCGGSWCCGPPIPPHPGP
INSSRAGAGAGASGWSSKGVRARAREPERRAPQLEPSDMSDPEMGWVPEPPAMTLGASRV
ELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERTEVLRSCSSPVFSRVLALEYFFE
EKQPLQFHVFDAEDGATSPSNDTFLGSIECTLGQIVSQTKVTKPLLLKNGKTAGKSTITI
VAEEVSGTNDYVQLTFRAHKLDNKDLFSKSDPFMEIYKTDGDQSDQLVWRTEVVKNNLNP
SWEPFRLSLHSLCSCDAHRPLKFLVYDYDSSGKHDFIGEFTSTFQEMQEGTANPGQEMQW
DCINPKYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIMGGCQISFTVAIDFTASNGDPRS
SQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDP
ENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVAGPAQREQSTGQATKYSVLLVLT
DGVVSDMAETRAAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLRCPRGVPAARDIV
QFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPCTPAPTPSPSP
Download sequence
Identical sequences M3Y4E5
ENSMPUP00000006196 ENSMPUP00000006196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]